• Home > species > guinea pig
  • Anti-DARS2 (guinea pig) antibodies
    Protein name(s) Uncharacterized protein;
    Gene name(s) DARS2;
    Cross ref(s) NULL
    Length 655 AA
    AbClass™ Easy (learn more)
    Sequence MHFSSWLSQLCKSLSRPIGRTTQPIWVSLSRNLVLRSQRKIPEEFSSFVARTNTCGELRPSHLGQEVTLCGWIQYRRQNVFLVLRDCHGLVQVIIPQDESAASVKKILCEAPLESVVQISGTVISRPPGQENPKMPTGAIEIKVKTAELLNSSKKLPFEIKDFVKKTEALRLQYRYLDLRSAQMQYNLRLRSQMVMKMREYLCNLHGFVDVETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMIGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIRNLIEGLLQYSWPSDKDPVVIPFPSMTFAEALASYGTDKPDTRFGMKITDVSEVFRNTESEFLQDALSKPQGTIKAICVQEGAKHLKRKEIESIRKCATDHFNQEVLPIFLKANSNWNSRAARLLVEEQRLELTRIMEAQEDDVVFLTAGEHGKTCSLLGKLRLECADLLEGRGVVLRDPTRFSFLWVVDFPLFLPKEDNPSELESAHHPFTAPHPSDRHLLYTAPEKVRSQHYDLVLNGNEIGGGSIRIHDAELQRYILSTLLKEDVTLLSHLLQALDYGAPPHGGIALGLDRLMCLVTGASSIRDVIAFPKSFRGHDLMSNAPDSVPAEELKPYHIQVSWPTDSEAEKSSLNHSYHPES
    Antibodies available

    Each product listed below is a combination of individual monoclonal antibodies (mAbs) against a panel of synthetic peptide antigens from the corresponding region of the target protein. Each combination of mAbs is recommended to be used directly. Later, they can be deconvoluted (if necessary) as individual monoclonal antibodies after epitope determination for each single mAb. Epitope determination service is available at $100 per combination.

    X-H0VH72 -N
    Description A combination of mouse monoclonal antibodies against H0VH72 N terminus sequence
    Antigen information 3 synthetic peptides representing the N terminus sequence
    Tested application ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB

    X-H0VH72 -C
    Description A combination of mouse monoclonal antibodies against H0VH72 C terminus sequence
    Antigen information 3 synthetic peptides representing the C terminus sequence
    Tested application ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB

    X-H0VH72 -M
    Description A combination of mouse monoclonal antibodies against H0VH72 M terminus sequence
    Antigen information 3 synthetic peptides representing the non-terminus sequence
    Tested application ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB
    Purchase Options for Total Protein Detection

    Choose a recommended package covered by AbInsure™ program.
    End-use Recommended package Price Description Availability
    WB X1 -H0VH72 $ 599 AbInsure™ Delivered in 30 days
    1 antibody combination included
    X-H0VH72 - N

    Or choose a single combination (NOT covered by AbInsure™ program)
    Antibodies available Price Availability
    X-H0VH72 -N $599 Delivered in 30 days
    X-H0VH72 -C $599 Delivered in 30 days
    X-H0VH72 -M $599 Delivered in 30 days

    Or freely design a custom antibody development project (NOT covered by AbInsure™ program).

    We design and produce custom monoclonal antibodies tailored for your specific needs. If you cannot find antibodies you need from the above list, please don't hesitate to contact us for a free consultation.

    - Functional (blocking or neutrualizing)

    - Family cross-reactive or family distinguishing

    - Specific epitope(s)

    - Other special needs

    search antibody
    Any protein in guinea pig
    From $599
    5 – 30 days to deliver
    Find yours by protein name,
    gene symbol or accession number